PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g05430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 377aa    MW: 41140.9 Da    PI: 8.1593
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g05430.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.27.5e-4183159278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC++dls++++yhrrhkvCe hsk+p+v++ gl+qrfCqqCsrfh+l++fDe+krsCr+rL++hn+rrrk+q+
  Vradi05g05430.1  83 CLVDGCNSDLSNCRDYHRRHKVCELHSKSPEVTIGGLKQRFCQQCSRFHSLEQFDERKRSCRKRLDGHNRRRRKPQP 159
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-3280144IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.70180157IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.85E-3881162IPR004333Transcription factor, SBP-box
PfamPF031102.6E-3083156IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MDKASIPNID SMEEHNRFGV YRMEGEFSVD LKLGHVGNSG TESALAKFKD VAAGAGVSKV  60
ASSPSGSSKR ARAINSTTLT VSCLVDGCNS DLSNCRDYHR RHKVCELHSK SPEVTIGGLK  120
QRFCQQCSRF HSLEQFDERK RSCRKRLDGH NRRRRKPQPE PHTRPGSFLS NYQDFSGTQL  180
LPFSNPHVYP SSAMMSTPWS GGLVTSSADA RLHNQHHHQE LFLGSSQKEG KQVAFLHGNH  240
PSTGALSNQS LPFPSPSVCH TLLRSSPLSE SCGARSKMFC ESLTTTNSVH DTPCALSLLS  300
SSQTHTPGNG LNQMVQAPSM SLMQPLGLSL QDNSNLESVE RVLVPNGSDH CSSMYSLGSD  360
GSHCNEAPQL FPFQWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28831561184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138155RKRSCRKRLDGHNRRRRK
2138156RKRSCRKRLDGHNRRRRKP
3139156KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014498396.10.0PREDICTED: squamosa promoter-binding-like protein 13A isoform X1
RefseqXP_014498397.10.0PREDICTED: squamosa promoter-binding-like protein 13A isoform X1
TrEMBLA0A0S3RG280.0A0A0S3RG28_PHAAN; Uncharacterized protein
STRINGGLYMA04G37391.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-67SBP family protein